PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036459
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRAS
Protein Properties Length: 535aa    MW: 59170.8 Da    PI: 6.3322
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036459genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS29.21.1e-0988142155
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                  lve Ll++Ae v ++ + la +lL     l+s++gdp+qR++ yf eAL++r+ r
  Lus10036459  88 LVEYLLAAAEKVGNQRHDLAANLLDLCDCLSSQTGDPVQRVVYYFSEALRTRIDR 142
                  5789*************************************************88 PP

2GRAS2552.7e-7822551781374
         GRAS  81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                  l+ ++e  P+++++hl a q +le + +++r+H+iD +i +GlQW a++qaLasRp + +  l+iT++g   ++sk++++etg+rL++fA++++vpf+
  Lus10036459 225 LQSLHENVPFYQVAHLSAIQILLENLGNSKRIHVIDVQIRYGLQWTAMMQALASRPdRTTELLKITALGT--NDSKDQIQETGRRLTSFARSINVPFD 320
                  46699***************************************************566679********..56************************ PP

         GRAS 178 fnvlvak..rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                  f++++a   +l dl++e+++++p+EalaV     l +  + + s+e     ++kl+++ +P++vvv e ea+hns +F++rf+eal  ysa+fd+l+ 
  Lus10036459 321 FKIVMAGspDLLDLQPEMFDIDPREALAVYTEGYLSNRIATPDSMEA----LMKLLRNFNPRIVVVLEVEANHNSRTFAHRFVEALFSYSAVFDCLDC 414
                  ***96654689999**********************99988888888....*********************************************99 PP

         GRAS 274 klpres.eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                   +  ++ e r++vE + l+++i+nvva+eg+er  r+ +   Wr  l ++ + + +ls  +  qakl+l++++  +  ++  + +sl+lgWkd p++s
  Lus10036459 415 CMEGQDfESRMVVESVGLREAISNVVAKEGEERGFRNVRIDVWRTLLARFSLVESKLSAVVLYQAKLVLKRFPsRRFCKLYVDGKSLILGWKDTPMIS 512
                  9988888******************************************************************55557899***************** PP

         GRAS 370 vSaWr 374
                  +S+W+
  Lus10036459 513 ISSWK 517
                  ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.17762496IPR005202Transcription factor GRAS
PfamPF035143.8E-788142IPR005202Transcription factor GRAS
PfamPF035149.4E-76225517IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MAAANSVNTG SESTAAESSN STKPSELPAG DEEVLSTNEI LRVAARRIIS MSTSSSTHTI  60
DLPSLMNNPF DLSPSSGISC QDAIRVELVE YLLAAAEKVG NQRHDLAANL LDLCDCLSSQ  120
TGDPVQRVVY YFSEALRTRI DRELGKGRVT GVEEAPGMIL LGNVSGIVCA ATGLPPILLL  180
QADGRRRSPN GPAARLNLAG DGFGICPARC RYFLNEDISI PSYLLQSLHE NVPFYQVAHL  240
SAIQILLENL GNSKRIHVID VQIRYGLQWT AMMQALASRP DRTTELLKIT ALGTNDSKDQ  300
IQETGRRLTS FARSINVPFD FKIVMAGSPD LLDLQPEMFD IDPREALAVY TEGYLSNRIA  360
TPDSMEALMK LLRNFNPRIV VVLEVEANHN SRTFAHRFVE ALFSYSAVFD CLDCCMEGQD  420
FESRMVVESV GLREAISNVV AKEGEERGFR NVRIDVWRTL LARFSLVESK LSAVVLYQAK  480
LVLKRFPSRR FCKLYVDGKS LILGWKDTPM ISISSWKFAR LRKHKEDEAL GLSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3310651721375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.17e-48RGA-like 2